Search Results

(606 ranking factors)

LR web_production: 2 Weight: 0.049061648412321 Link relevance. The factor will be remarked.
PrBonus web_production: 3 Weight: 0.07124278745128 Priority bonus, priority 7 - text priority. The binary factor, matters 0 for all monosyllabic requests, and the value of 1 for almost all two or more words, except for a very small number of answers for which there is not a single link that has passed quorum, and the text also did not pass the quorum.
LRp1 web_production: 6 (strict) there is all the words of the request in one link.
PureText web_production: 18 Long text without links.
TRboost web_production: 26 The number for which some linseed factors are multiplied (namely, factors number 6, 7, 47, 66), if text relevant 0, and there are few links
LRHitNumGt16 web_production: 32 The document LR> 20 The number of words of the words of the request in the Links> 16, the factor about LR.
PctLinks web_production: 33 Weight: -0.141668202468497 For documents with a high LR, a normalized lincat relevance excluding proximity, for documents with a low LR 0
LinkQuality web_production: 35 Weight: -0.001564275785704 The quality of incoming links (the classifier of the bream) is broken, cm [405]
NumLinks web_production: 37 The number of incoming links. Remembrance.
LinkBM25 web_production: 47 Simple BM25 for links, the weights of the braces are not taken into account.
TLBM25 web_production: 48 Weight: 0.031399776481102 Simple BM25 in text and links at the same time.
TLp1 web_production: 49 All the words of the request are in the text + links.
LnkPair web_production: 54 The same as txtpair, but for links; Link weights are not taken into account.
Megafon web_production: 80 The relative frequency of the words in the links (1 - the words of the request are often found in links, 0.3 - rarely); More precisely, the value of this factor is pessimized provided: TR = 0 && LR = 0 & (there is not a single link with all the words of the request) && (did not pass the quorum) && (at least one pair of words of the request is found in the text)
XLRp0 web_production: 81 There are all the words of the request in the links
XLRp1 web_production: 82 There are all the words of the request in one link
XLRp2 web_production: 83 Weight: 0.0051601584234 There is a link that has passed quorum
XLRgood web_production: 84 Weight: -0.00083343707893 What is the share of “good” links
XLRmanyBad web_production: 85 How many “bad” links (bad = DPR = 0)
XLRmaxDpr web_production: 86 Weight: -0.065082391728977 Maximum DPR links
XLRtfidf web_production: 87 TFIDF ordinary TF*IDF by links. The frequency of the word in the links is multiplied by the reverse document frequency and summarized in all words, then it is normalized to the length of the document.
XLRrelev web_production: 88 Linkovaya relevance by Gulina
XLRrelev200 web_production: 89 Linkovaya relevance by Gulina
XLRlogRelev web_production: 90 Linkovaya relevance by Gulina
NewLinkQuality web_production: 94 Weight: 0.021178675054476 The quality classifier of incoming links 2 is broken, cm [407]
XLExactMatches web_production: 109 The number of links that exactly coincide with a request
LinkSpeed web_production: 115 Weight: 0.009455905387837 The number of reverse dispersion times of the appearance of links with the words of the request
XThLRrelev web_production: 116 Link relevance, taking into account thematicity
XThLRrelev200 web_production: 117 Link relevance, taking into account thematicity
XThLRlogRelev web_production: 118 Link relevance, taking into account thematicity
XLerfLRrelev web_production: 119 Link relevance, taking into account the quality of each link
XLerfLRrelev200 web_production: 120 Link relevance, taking into account the quality of each link
XLerfLRlogRelev web_production: 121 Weight: 0.060594485044371 Link relevance, taking into account the quality of each link
XLerfThLRlogRelev web_production: 122 Link relevance, taking into account the quality of each link and thematicity of each link
XNonCommLRlogRelev web_production: 123 Link relevance, taking into account the non -profitability of each link
XNonCommThLRlogRelev web_production: 124 Link relevance, taking into account the non -profitability of each link and thematic
XNonCommLerfLRlogRelev web_production: 125 Link relevance, taking into account the non -profitability of each link and quality of each link
XNonCommLerfThLRlogRelev web_production: 126 Link relevance, taking into account the non -profitability of each link, the quality of each link and thematicity
LinksWithWordsPercent web_production: 128 Weight: -0.060922780495065 The percentage of incoming links with the words of the request
LinksWithAllWordsPercent web_production: 129 Weight: -0.08383112850758 The percentage of incoming links with all the words of the request
NumWordsLR web_production: 141 The percentage of the words of the request in the links (with an accuracy to a synonym)
HasAllWordsLR web_production: 142 There are all the words of the request in the links (with an accuracy to a synonym)
XLExactMatchesMap web_production: 155 The number of links that coincide with the text of the request (other Remap)
XLerfNormLRlogRelev web_production: 156 Xlerflrlogrelev (normalized for the amount of LerF-wwees of all links, and not for the amount of their source scales)
XNonCommNormLRlogRelev web_production: 157 Weight: 0.062474190501436 Xnoncommlrlogrelev (normalized for the amount of noncomm all links, and not for the amount of their source scales)
XNonCommThNormLRlogRelev web_production: 158 Link relevance, taking into account the non -profitability of each link and thematic
XNonCommLerfNormLRlogRelev web_production: 159 Xnoncommelrfnormlrlogrelev (normalized for the amount of noncommlrf-wigles of all links, and not for the amount of their source scales)
XNonCommLerfThNormLRlogRelev web_production: 160 Link relevance, taking into account the non -profitability of each link, the quality of each link and thematicity
LinkAge web_production: 163 Weight: 0.000426528744914 The average age of links that brought something to LR linkage = min (log (average age of links)/7, 1), 3 years are adopted for 1
IsUnreachable web_production: 165 The page is unattainable by the links from the muzzle.
XLerfLangLRlogRelev web_production: 167 Weight: 0.000094696411924 LR, taking into account the coincidence of the language of the link and request and accuracy
LinkMaxAge web_production: 184 The maskimal age of a significant accumulation of links that brought something to LR
IsLinkPessimised web_production: 202 Antispamers pessimized the site - all dynamic linseed factors are reset. Zerolnk.flt
XLRGeoRelevRegionCountry web_production: 220 Weight: 0.042452794899003 Three levels of coincidence of the region of links and request
RingsHostRankBadnessOld web_production: 248 Weight: -0.036532955371613 Characterizes the promotion of the site with ling rings. Value is the share of external links that are included in the lingon rings and battleships.
YabarHostInternalTraffic web_production: 251 Weight: 0.071417326810502 The share of suits to the site is not by links (set with hands or from bookmarks)
XLRVideoRelev web_production: 267 Link factor about the presence of a video on the page.
AuxLinkBM25 web_production: 269 The same for lingonic relevance
CommLinksSEOHosts web_production: 270 Weight: -0.180963639077109 The share of incoming corrupt links. The algorithm for recognition of commercial links is implemented. The factor will be remarked to [0.1] if the share of such links is 50%, otherwise 0. ((http://wiki.yandex-team.ru/svetlanashorina/topseolinks selection of wound sites))))))
CommLinksSEOHostsPornoQuery web_production: 271 Previous factor multiplied by Pornoquery
CommLinksSEOHostsNonComm web_production: 272 Weight: 0.0033634994869 ComMlinksseohosts factor multiplied by Noncommercialquery
LCor web_production: 281 Weight: 0.038372460585705 Characterizes the frequency of words in links. The factor is large, if the word that played in a lincoat relevance is rare for links.
LRDocQuorum web_production: 284 The weight of the words of the request that is in the Links
TRLRDocQuorum web_production: 285 The weight of the words of the request that is in the text and links
LnkBreak web_production: 302 Weight: 0.078872214489662 Analogs of the corresponding text factors for links. BM25 from the number of links in which a coincidence occurred.
LnkBm25Ex web_production: 303 Simple BM25 in the exact form in link texts
LnkPairSy web_production: 304 Weight: 0.046891090311905 The presence of pairs in the links of the words, taking into account synonyms
LnkBrkSy web_production: 305 Weight: 0.035447186193336 The number of links passed the threshold
LnkBm25Sy web_production: 306 Simple BM25 by links taking into account synonyms
XLRMarketRelev web_production: 318 LR by links from Yandex.Market
LRAmortizedByAge web_production: 363 Weight: 0.003128580544172 Link relevance with pessimization for great age Link
PercentWordsInLinks web_production: 367 Weight: 0.057053549836014 The percentage of the number of words inside the tag <a> .. </a> from the number of all words
CInDegree1 web_production: 382 The host factors determine the sites screwed by the links-the second and third incoming degrees ((http://wiki.yandex-team.ru/jandekspoisk/kachestvopoiska/obshayAformula/tekushhiekomponenty/antispam?v=181rh58958953
CInDegree2 web_production: 383 Weight: 0.000692523218694 The host factors determine the sites screwed by the links-the second and third incoming degrees ((http://wiki.yandex-team.ru/jandekspoisk/kachestvopoiska/obshayAformula/tekushhiekomponenty/antispam?v=181rh58958953
NumNonRussianLinks web_production: 384 The number of incoming links without Russian letters. Remembrance.
LinkMaxForms web_production: 388 The maximum number of forms in all words of the request
LinkWeightedForms web_production: 389 Weight: 0.096811143316269 Summer of the number of forms balanced by scales
LinkForms web_production: 390 Undested amount of the number of forms
LinkBM25_W1 web_production: 395 Analogues of the factors of the same name, the weight of the word = 1
LinkQualityFixed web_production: 405 Weight: 0.013112575551553 Quality of incoming links (hauser classifier) corrected
HasLinkQualityFixed web_production: 406 Considered LinkQuality for this page or not (did not think, if there are few links) corrected
NewLinkQualityFixed web_production: 407 Weight: 0.021178675054476 Quality classifier of incoming links 2 corrected
LRWithoutRare web_production: 413 Weight: -0.011221458184058 Link relevance without taking into account rare words
DifferentInternalLinks web_production: 414 Weight: 0.096447224363928 The number of different internal links to the page
PeriodicLinkDatesPercent web_production: 430 Weight: 0.013900531929943 The frequency of links to the site
LinkAlmostPeriod web_production: 431 The number of almost-periodic links
BM25FdPR_obsolete web_production: 481 Weight: 0.054156294329288 BM25 with different parameters for different fields, including an incoming anchortekst. The weight of the text of the links included on the page is normalized depending on Delta Page Rank links
InlinksModel web_production: 503 Probabilistic model built on the texts of incoming links
QueryWordSequencesLR web_production: 505 He considers the sum of the following species: the sequence of words of the request more than two, met in one link; It is normalized to the number of links.
NumLinksFromMP web_production: 526 The number of incoming muzzle links
FullQuorum web_production: 528 Binary factor, every word of the request is in the text or in the links
AuxCLinkBM25 web_production: 530 'Country praets' (AUXQC)
NumLinksFromSegmentContent web_production: 557 Weight: 0.094045741102708
GeoDispersion web_production: 564 Document links dispersion
RelevGeoLinksPercent web_production: 573 Weight: -0.069803680024687
UrlLinkPercent web_production: 578 Weight: 0.089404211238337 The ratio of the number of incoming links, the text of which is the URL, is one of the incoming links
StaticTitleLRBM25 web_production: 585 Weight: 0.038263040612831 BM25 page title by texts of links to it
SeoInPayLinks web_production: 586 Weight: -0.028595315195293 The number of COO-Thrilling links between hosts
TitleInLinksTrigrams web_production: 597 Weight: -0.076334972364641 The share of unique trigrams in the trigrams of links
LinksInTitleTrigrams web_production: 598 Weight: 0.019301158836494 Share of unique trigrams of links in trigrams header
SOMaxSumSourceRank web_production: 605 Weight: 0.061675217167197 The sum of the maximum values of Sourcerank's for each incoming link, taking into account the uniqueness of the owner.
DBM35 web_production: 606 Weight: 0.046757967567051 BM25 in texts and links with special. Libra in the level of coincidence (shape, lemma, synonym)
LinksAlive web_production: 620 Allows you to evaluate whether the document is 'alive' is from the point of view of links to it coming.
SynSetLinkBM25 web_production: 637 A copy of the LinkBM25 factor for ((http://wiki.yandex-team.ru/jandekspoisk/kachestvopoiska/obshayafformula/tekushhiekomponenty/synset Sinsetov)).
FooterInLinksTrigrams web_production: 648 The share of unique trigrams of a footer fragment in trigrams of links
LinksInFooterTrigrams web_production: 649 The share of unique trigrams of links among a fragment of trigrams of a footer
XLerfGeoLRlogRelevCnt web_production: 675 Regionalized (only links from the country of request are taken) variant of the Xlerfgeolrlogrelev factor
XNonCommLerfNormLRlogRelevCnt web_production: 676 Regionalized (only links from the country of request are taken) variant of the factor XNONCOMMLERFNORMLRLOGRELAV
LocmCnt web_production: 677 Regionalized (only links from the country of request are taken) Variant of Locm factor
XLRrelevCnt web_production: 678 Regionalized (only links from the country of request are taken) variant of factor xlrrelev
XLerfLRrelev200Cnt web_production: 679 Regionalized (only links from the country of request are taken) variant of factor Xlerflrrelev200
HasDownloadLinkOnFile web_production: 682 The document has a direct link to the file
HasDownloadLinkOnFileHosting web_production: 683 The document has a link to filehosting
LcmVar web_production: 711 Dispersion of the number of words in the links.
Cabm web_production: 714 BM with attenuation in the text of catalog links.
WikiLinkCount web_production: 738
UrlInLinksTrigramsStatic web_production: 739
LinksInUrlTrigramsStatic web_production: 740
Bclmf web_production: 771 BCLM for Annotation index, doc text and links.
DoppQueryUrlSessionClicksFRC web_production: 792 What part (on average in the session) from the clinked in this query Urlov is this URL. It is considered to be user sessions.
WikiInfobox web_production: 854 On danny url is a link from inFobox-ov to Wikipedia.
CorrectedCtrXfactorBclmPlainK3 web_production: 955 CorrectedctrxFactor in the annotation index, BCLMPLALINK3 factor
XLRAnnotationMatchPrediction web_production: 972 It is considered to be a linkend index. Max (SUM (IDF)) for all links that are the subset of Query / Sum (IDF) for Query
XfDtShowAllMaxWFLinksAllPerWordCMMaxMatchMin web_production: 1321 Linguistic boosting factor. Type of extensions: XFDTSHOW. Factor: perwordcmmaxMatchmin for incoming links. The maximum balanced value of the expansion factor.
UBLongPeriodDirectHChildren90CntFromExtHost web_production: 1368 Static URL factor in browser logs for the maximum period. The average number of direct descendants from the host on which they spent more than 90 seconds. The descendant is straight, only if there is a link from our page to the descendant and crossed it.
AllMatchedWordWeightsSum web_production: 1407 The normalized amount of the scales of the words of the request that met in the text of the document or links to it.
StringMatchedWordWeightsSum web_production: 1408 The normalized amount of the scales of the words of the request that Equal_by_String in the text of the document or links to it.
AllMatchedWordWeightsSumLink web_production: 1410 The normalized amount of the scales of the words of the request that met in the links to the document.
StringMatchedWordWeightsSumLink web_production: 1411 The normalized amount of the scales of the words of the request that Equal_by_String in the links to the document.
AllMatchedWordFiltrationModelWeightsSum web_production: 1412 The normalized scales for the IFILTRETRATIONMODEL words of the request that met in the text of the document or links to it.
StringMatchedWordFiltrationModelWeightsSum web_production: 1413 The normalized scales for the IFILTRETRATIONMODEL Words of the request, which are Equal_by_String in the text of the document or links to it.
LemmaMatchedWordFiltrationModelWeightsSum web_production: 1414 The normalized scales for the IFILTRETRATIONMODEL Words of the request, which Equal_by_lemma in the text of the document or links to it.
AllMatchedWordFiltrationModelWeightsSumLink web_production: 1415 The normalized scales for the IFILTRETRATIONMODEL words of the request that met in links to the document.
StringMatchedWordFiltrationModelWeightsSumLink web_production: 1416 The normalized scales for the IFILTRETRATIONMODEL Words of the request, which Equal_by_String in the links to the document.
QfufAllMaxFLinkAnnIndicatorAnnotationMaxValueWeighted web_production: 1417 Linguistic boosting factor. Type of extensions: QFUF. Aggregation on all extensions. The greatest value of the factor. According to the stream from the lincum index of Linkannindicator. AnnotationmaxvalueWeighted algorithm - maximum weight (according to Mainweights Libra of Words) Operations coverage, weighed to the weight of the annotation
QfufAllMaxWFLinkAnnIndicatorFullMatchValue web_production: 1418 Linguistic boosting factor. Type of extensions: QFUF. Aggregation on all extensions. The greatest value of the factor. According to the stream from the lincum index of Linkannindicator. AnnotationmaxvalueWeighted algorithm - maximum weight (according to Mainweights Libra of Words) Operations coverage, weighed to the weight of the annotation
XfDtShowAllMaxWFMaxWLinkAnnIndicatorPerWordCMMaxMatchMin web_production: 1419 Linguistic boosting factor. Type of extensions: XFDTSHOW. Aggregation on all extensions. The greatest balanced value of the factor. It is normalized for the maximum weight of expansion. According to the stream from the lincum index of Linkannindicator. PerwordCmmaxMatchMin algorithm: The minimum according to CMMMAXMATCH weight.
RandomLogQueryAvgDifferentInternalLinks web_production: 1444 The average value is DifferentinTernallinks for the year. It is calculated in offline.
RandomLogQueryClicksWeightedAvgDifferentInternalLinks web_production: 1460 Maintened by clicks DifferentinTernallinks for the year. It is calculated in offline.
BM25FdPRFixedNoLinks web_production: 1462 BM25FDPR with standardization on the average length of the document, depending on the language of the document. Only texts are used.
RequestWithRegionNameLinkAnnFloatMultiplicityCMMatchTop5AvgMatchValue web_production: 1516 Linguistic boosting factor. Type of extensions: Requestwithregionname. Factor: CMMATCHTOP5AVGMATCHVAVALU on Stream Floatmultiplicity Linkann index
LinkAnnLinkAnnFloatMultiplicityPerWordAMMaxValueMin web_production: 1518 Linguistic boosting factor. Factor: Perwordammaxvaluemin for stream Floatmultiplicity Linkann index
LinkAnnFloatMultiplicityAttenV1Bm15K001 web_production: 1519 Linguistic boosting factor. Factor: Attenv1bm15K001 according to the stream Floatmultiplicity of the Linkann index
LinkAnnLinkExternalBocm11Norm256 web_production: 1520 Linguistic boosting factor. Factor: BOCM11NORM256 according to the stream of the ISEXTERNAL Linkann index
RequestWithRegionNameLinkAnnFloatMultiplicityAnnotationMaxValue web_production: 1522 Linguistic boosting factor. Type of extensions: Requestwithregionname. Factor: Annotationmaxvalue Stream Floatmultiplicity Linkann index
DssmRandomLogQueryAvgDifferentInternalLinks web_production: 1555 The average DifferentinTernallinks for the year for the year.
DssmRandomLogQueryClicksWeightedAvgDifferentInternalLinks web_production: 1571 DiffferentinTernallinks, which is predicted using a neural network, is a weighted net with clicks for a year.
KnnRandomLogQueryAvgDifferentInternalLinks web_production: 1688 The average value of Randomlogqueryavgdiferentinternallinks of the nearest KNN queries.
HostCy100log web_production: 1695 Quality link from good sites estimation
RandomLogHostNumLinksFromMPMax web_production: 1737 MAX aggregation of NumLinksFromMP web factor using random log
RandomLogHostWikiLinkCountLogAvg web_production: 1754 LOGAVG aggregation of WikiLinkCount web factor using random log
RandomLogHostDssmRandomLogQueryAvgDifferentInternalLinksLogAvg web_production: 1760 LOGAVG aggregation of DssmRandomLogQueryAvgDifferentInternalLinks web factor using random log
RandomLogOwnerMetaRmsDifferentInternalLinksPerc25 web_production: 1806 Owner aggregation of MetaRmsDifferentInternalLinks meta factor using random log, aggregation type is PERCENTALE_25
RandomLogOwnerLinkAnnFloatMultiplicityAttenV1Bm15K001LogAvg web_production: 1813 Owner aggregation of LinkAnnFloatMultiplicityAttenV1Bm15K001 web factor using random log, aggregation type is LOGAVG
RandomLogOwnerNumLinksFromMPLogAvg web_production: 1815 Owner aggregation of NumLinksFromMP web factor using random log, aggregation type is LOGAVG
RandomLogOwnerDssmRandomLogQueryAvgDifferentInternalLinksPerc25 web_production: 1816 Owner aggregation of DssmRandomLogQueryAvgDifferentInternalLinks web factor using random log, aggregation type is PERCENTALE_25
OriginalRequestWordsFilteredByDssmSSHardFieldSet1Bm15FLogK0001 web_production: 1853 The factor for the filtered original request: the DSSM state from the request is calculated without words to the initial request, after which the threshold is cut off. Into aircraft association of the URLs, Title, Body, Links, Correctedctr, LongClick, OneClick, Browserpagerank, Splitdwelltime, SampleperiodDayFrc, SimpleClick, Yabarvisits, Yabartime. The algorithm for aggregation of the scales of words: BM15FLOG (BM15 Aggregation of Logarithm of Construction of Words). Normalization coefficient 0.001.
XfOneSeKnnAllMaxWFMaxWFieldSet1Bm15FLogK0001 web_production: 1864 Linguistic boosting factor. Type of extensions: XFONESEKNN (closest to the DSSM models trained to predict XFDTSHOW of extension). Aggregation on all extensions. The greatest balanced value of the factor. It is normalized for the maximum weight of expansion. Into aircraft association of the URLs, Title, Body, Links, Correctedctr, LongClick, OneClick, Browserpagerank, Splitdwelltime, SampleperiodDayFrc, SimpleClick, Yabarvisits, Yabartime. The algorithm for aggregation of the scales of words: BM15FLOG (BM15 Aggregation of Logarithm of Construction of Words). Normalization coefficient 0.001.
RandomLogQueryAvgDifferentInternalLinks begemot_query_factors: 98 The average value is DifferentinTernallinks for the year. It is calculated in offline.
RandomLogQueryClicksWeightedAvgDifferentInternalLinks begemot_query_factors: 114 Maintened by clicks DifferentinTernallinks for the year. It is calculated in offline.
DssmRandomLogQueryAvgDifferentInternalLinks begemot_query_factors: 135 The average DifferentinTernallinks for the year for the year.
DssmRandomLogQueryClicksWeightedAvgDifferentInternalLinks begemot_query_factors: 149 DiffferentinTernallinks, which is predicted using a neural network, is a weighted net with clicks for a year.
KnnRandomLogQueryAvgDifferentInternalLinks begemot_query_factors: 172 The average value of Randomlogqueryavgdiferentinternallinks of the nearest KNN queries.
WikiFactsLinks blender_production: 75 Number of wiki page shows per 2 months according to Wikipedia data
WikiFactsLogrelWebWikilinks blender_production: 81
VideoDocAgg4MaxBestLinkBocm blender_production: 702 Maximum value of top-4 video docs factor: BestLinkBocm
ImagesBigramUINavCTRMax blender_production: 733 Maximal norm bigram images navigational link CTR, calculate on current user interface slice
AddressBigramNavCTRMax blender_production: 756 Maximal norm bigram maps navigational link CTR, calculate on desktop slice
VideoDWordNavCTRMax blender_production: 763 Doppel word maximal CTR for video navigational link, calculate on desktop slice
VideoDQueryNavCTR blender_production: 769 Doppel query CTR for video navigational link, calculate on desktop slice
ImagesQuickImageLinksFromNewsMean blender_production: 1017 Imagelinksfromnews of a quick source
img_erf_RawLinkCount_avg collections_production: 150
img_erf_LinkCount_avg collections_production: 155
ti2c_link_portion collections_production: 310
ti2c_link_rel collections_production: 313
ti2c_link_rel_portion collections_production: 316
PERCENT_WORDS_IN_LINKS goods_production: 437
TITLE_IN_LINKS_TRIGRAMS goods_production: 445
LINKS_IN_TITLE_TRIGRAMS goods_production: 447
URL_IN_LINKS_TRIGRAMS goods_production: 451
LINKS_ALIVE goods_production: 460
IS_LINK_PESSIMISED goods_production: 487
COMM_LINKS_HOST_SEO goods_production: 562
SEO_IN_PAY_LINKS goods_production: 600
MRKT_IMG_LINK_DATA_ALL_WCM_MATCH95_AVG_VALUE goods_production: 1321
MRKT_IMG_LINK_DATA_ALL_WCM_MAX_PREDICTION goods_production: 1322
MRKT_IMG_LINK_DATA_ALL_WCM_WEIGHTED_VALUE goods_production: 1323
MRKT_IMG_LINK_DATA_ANNOTATION_MAX_VALUE_WEIGHTED goods_production: 1324
MRKT_IMG_LINK_DATA_ATTEN_V1_BM15_K001 goods_production: 1325
MRKT_IMG_LINK_DATA_BCLM_PLANE_PROXIMITY1_BM15_W0_SIZE1_K001 goods_production: 1326
MRKT_IMG_LINK_DATA_BM15_MAX_ANNOTATION_K001 goods_production: 1327
MRKT_IMG_LINK_DATA_FULL_MATCH_ANY_VALUE goods_production: 1328
MRKT_IMG_LINK_DATA_FULL_MATCH_VALUE goods_production: 1329
MRKT_IMG_LINK_DATA_MIX_MATCH_WEIGHTED_VALUE goods_production: 1330
BG_RANDOM_LOG_QUERY_AVG_DIFFERENT_INTERNAL_LINKS goods_production: 2213 The average value is DifferentinTernallinks for the year. It is calculated in offline.
BG_RANDOM_LOG_QUERY_CLICKS_WEIGHTED_AVG_DIFFERENT_INTERNAL_LINKS goods_production: 2229 Maintened by clicks DifferentinTernallinks for the year. It is calculated in offline.
BG_DSSM_RANDOM_LOG_QUERY_AVG_DIFFERENT_INTERNAL_LINKS goods_production: 2250 The average DifferentinTernallinks for the year for the year.
BG_DSSM_RANDOM_LOG_QUERY_CLICKS_WEIGHTED_AVG_DIFFERENT_INTERNAL_LINKS goods_production: 2266 DiffferentinTernallinks, which is predicted using a neural network, is a weighted net with clicks for a year.
BG_KNN_RANDOM_LOG_QUERY_FACTORS_RANDOM_LOG_QUERY_AVG_DIFFERENT_INTERNAL_LINKS goods_production: 2326
LinkCount images_cbir: 86
SrcShopShare images_cbir: 226 Shop share of passage links
SrcLinkCountQ15 images_cbir: 228 15th percentile of link count on page
SrcShopLinkCountMedian images_cbir: 230 Median of link count on shop page
LinkInstockMax images_cbir: 231 Maximum battleship on passage lincers
LinkInstockQ90 images_cbir: 232 90th Perstale Persian probability of Instock on passage links
LinkInstockAve images_cbir: 233 The average baton of Instock on the passage bursts
MarketPassageCount images_cbir: 240 Number of passage links with market url in document
PokupkiPassageCount images_cbir: 241 Number of passage links with pokupki url in document
LinkInstockMaxRegionMetric images_cbir: 255 The maximum battleship of Instock on passage linches corresponding to the regional request according to metric
ImgVisualQualityMedian images_l1: 2 The median value of the Visual Quality classifier among Links
ImgVisualQualityMax images_l1: 3 The maximum value of the Visual Quality classifier among Links
ImgStaticUtilityMedian images_l1: 11 The median value of the static classifier Utiley pictures among Links
ImgStaticUtilityMax images_l1: 12 The maximum value of the static classifier of the Utiley pictures among Links
ImgVisualQualityV2Median images_l1: 17 Median value of the Visual Quality V2 classifier among Links
ImageText2TextRelevanceV2 images_l1: 59 Relevance of the image based on DSSM query + features of selected links
DssmRandomLogQueryAvgDifferentInternalLinks images_l1: 63 The average DifferentinTernallinks for the year for the year.
MaxImageAreaSigmoid images_l1: 65 Sigmoid of maximum image area among actually selected links
MedianImageAreaSigmoid images_l1: 66 Sigmoid of meadian image area among actually selected links
RandomLogQueryAvgDifferentInternalLinks images_l1: 73 The average value is DifferentinTernallinks for the year. It is calculated in offline.
ImageText2TextBundleRelevanceV2 images_l1: 78 Relevance of the image based on dssm query extensions + features of selected links
ImgAesteticsMedian images_l1: 120 The median value of the classifier of the aesthetics of pictures among Links
ImgAesteticsMax images_l1: 121 The value of the aesthetics classifier of the pictures among links is as much as possible
LinkCount images_market_l4: 28
SrcShopShare images_market_l4: 255 Shop share of passage links
SrcLinkCountQ15 images_market_l4: 257 15th percentile of link count on page
SrcShopLinkCountMedian images_market_l4: 259 Median of link count on shop page
LinkInstockMax images_market_l4: 260 Maximum battleship on passage lincers
LinkInstockQ90 images_market_l4: 261 90th Perstale Persian probability of Instock on passage links
LinkInstockAve images_market_l4: 262 The average baton of Instock on the passage bursts
MarketPassageCount images_market_l4: 269 Number of passage links with market url in document
PokupkiPassageCount images_market_l4: 270 Number of passage links with pokupki url in document
LinkInstockMaxRegionMetric images_market_l4: 284 The maximum battleship of Instock on passage linches corresponding to the regional request according to metric
LinkCount images_market: 28
SrcShopShare images_market: 267 Shop share of passage links
SrcLinkCountQ15 images_market: 269 15th percentile of link count on page
SrcShopLinkCountMedian images_market: 271 Median of link count on shop page
LinkInstockMax images_market: 272 Maximum battleship on passage lincers
LinkInstockQ90 images_market: 273 90th Perstale Persian probability of Instock on passage links
LinkInstockAve images_market: 274 The average baton of Instock on the passage bursts
MarketPassageCount images_market: 281 Number of passage links with market url in document
PokupkiPassageCount images_market: 282 Number of passage links with pokupki url in document
LinkInstockMaxRegionMetric images_market: 296 The maximum battleship of Instock on passage linches corresponding to the regional request according to metric
RandomLogQueryAvgDifferentInternalLinks images_new_l1: 98 The average value is DifferentinTernallinks for the year. It is calculated in offline.
RandomLogQueryClicksWeightedAvgDifferentInternalLinks images_new_l1: 114 Maintened by clicks DifferentinTernallinks for the year. It is calculated in offline.
DssmRandomLogQueryAvgDifferentInternalLinks images_new_l1: 135 The average DifferentinTernallinks for the year for the year.
DssmRandomLogQueryClicksWeightedAvgDifferentInternalLinks images_new_l1: 149 DiffferentinTernallinks, which is predicted using a neural network, is a weighted net with clicks for a year.
KnnRandomLogQueryAvgDifferentInternalLinks images_new_l1: 172 The average value of Randomlogqueryavgdiferentinternallinks of the nearest KNN queries.
MediaForumLinksShare images_new_runtime_doc_features: 20
ImageTemporalLinksWeight images_new_runtime_doc_features: 40
MediaLinks images_new_runtime_doc_features: 44
ImageLinksFromNews images_new_runtime_doc_features: 45
ImgVisualQualityMedian images_new_runtime_doc_features: 57 The median value of the Visual Quality classifier among Links
ImgVisualQualityMax images_new_runtime_doc_features: 58 The maximum value of the Visual Quality classifier among Links
DocHasWikimedia images_new_runtime_doc_features: 61 TSource or TDestination has link from wikimedia web-sites http://www.wikimedia.org/
MaxImageAreaSigmoid images_new_runtime_doc_features: 90 Sigmoid of maximum image area among actually selected links
MedianImageAreaSigmoid images_new_runtime_doc_features: 91 Sigmoid of meadian image area among actually selected links
MaxPresentImageArea images_new_runtime_doc_features: 116 Max image area sigmoid among links of doc (instead of destinations)
ImgStaticUtilityMedian images_new_runtime_doc_features: 153 The median value of the static classifier Utiley pictures among Links
ImgStaticUtilityMax images_new_runtime_doc_features: 154 The maximum value of the static classifier of the Utiley pictures among Links
ImgVisualQualityV2Median images_new_runtime_doc_features: 155 Median value of the Visual Quality V2 classifier among Links
ImgVisualQualityV2Max images_new_runtime_doc_features: 156 The maximum value of the Visual Quality V2 classifier is among Links
ImgAesteticsMedian images_new_runtime_doc_features: 157 The median value of the classifier of the aesthetics of pictures among Links
ImgAesteticsMax images_new_runtime_doc_features: 158 The value of the aesthetics classifier of the pictures among links is as much as possible
MinLinkAdultnessBetaLevel images_new_runtime_doc_features: 170 Level of minimal AdultnessBeta values among selected links (0.1 = MinAdultnessBetaAboveFamilyThreshold, 0.3 - MinAdultnessBetaAboveGrayThreshold, 0.5 - MinAdultnessBetaAboveNormalThreshold
PassageCount images_new_runtime_doc_features: 179 Number of passage links in document
HasHotLink images_new_runtime_doc_features: 193 HasHotLink
HasTurkeyLink images_new_runtime_doc_features: 196 HasTurkeyLink
RawLinkCount images_new_runtime_doc_features: 205 RawLinkCount
SrcShopShare images_new_runtime_doc_features: 230 Shop share of passage links
SrcLinkCountQ15 images_new_runtime_doc_features: 232 15th percentile of link count on page
SrcShopLinkCountMedian images_new_runtime_doc_features: 234 Median of link count on shop page
LinkInstockMax images_new_runtime_doc_features: 308 Maximum battleship on passage lincers
LinkInstockQ90 images_new_runtime_doc_features: 309 90th Perstale Persian probability of Instock on passage links
LinkInstockAve images_new_runtime_doc_features: 310 The average baton of Instock on the passage bursts
LinkInstockMaxRegionMetric images_new_runtime_doc_features: 311 The maximum battleship of Instock on passage linches corresponding to the regional request according to metric
IsSocialMediaDocument images_new_runtime_doc_features: 333 Does the document have links from social networks
IsSocialMediaDocumentVerifiedOwner images_new_runtime_doc_features: 334 Does the document have Linka from social networks of a verified user
IsSocialMediaDocumentMaxFollowerCount images_new_runtime_doc_features: 335 For the document, the maximum number of followers in Linka from social networks.
IsSocialMediaDocumentMaxRepostCount images_new_runtime_doc_features: 336 For the document, the maximum number of reposts in Linka from social networks.
IsSocialMediaDocumentMaxLikesCount images_new_runtime_doc_features: 337 For the document, the maximum number of likes in Linka from social networks.
HasTurkeyLink images_nn_over_dssm_doc_features: 1 HasTurkeyLink
RawLinkCount images_nn_over_dssm_doc_features: 7 RawLinkCount
HasHotLink images_nn_over_dssm_doc_features: 12 HasHotLink
ForumLinksShare images_nn_over_dssm_doc_features: 59 ForumLinksShare
TemporalLinksWeight images_nn_over_dssm_doc_features: 70 TemporalLinksWeight
LinkCount images_nn_over_dssm_doc_features: 75 LinkCount
NewsLinksShare images_nn_over_dssm_doc_features: 76 NewsLinksShare
HasWikimediaLink images_nn_over_dssm_doc_features: 100 HasWikimediaLink
ImgVisualQualityMax images_nn_over_dssm_doc_features: 146 The maximum value of the Visual Quality classifier among Links
MedianImageAreaSigmoid images_nn_over_dssm_doc_features: 148 Sigmoid of meadian image area among actually selected links
MaxImageAreaSigmoid images_nn_over_dssm_doc_features: 149 Sigmoid of maximum image area among actually selected links
ImgStaticUtilityMax images_nn_over_dssm_doc_features: 168 The maximum value of the static classifier of the Utiley pictures among Links
ImgStaticUtilityMedian images_nn_over_dssm_doc_features: 169 The median value of the static classifier Utiley pictures among Links
ImgVisualQualityV2Median images_nn_over_dssm_doc_features: 171 Median value of the Visual Quality V2 classifier among Links
ImgAesteticsMax images_nn_over_dssm_doc_features: 172 The value of the aesthetics classifier of the pictures among links is as much as possible
ImgAesteticsMedian images_nn_over_dssm_doc_features: 173 The median value of the classifier of the aesthetics of pictures among Links
MediaForumLinksShare images_production: 30
ImageText2TextRelevanceV2 images_production: 43 Relevance of the image based on dssm query + features of selected links
ImageTemporalLinksWeight images_production: 76
MediaLinks images_production: 82
ImageLinksWithAllWords images_production: 85
ImageLinksFromNews images_production: 87
ImgVisualQualityMedian images_production: 168 The median value of the Visual Quality classifier among Links
ImgVisualQualityMax images_production: 169 The maximum value of the Visual Quality classifier among Links
DocHasWikimedia images_production: 189 TSource or TDestination has link from wikimedia web-sites http://www.wikimedia.org/
ImageText2TextBundleRelevanceV2 images_production: 244 Relevance of the image based on dssm query extensions + features of selected links
MaxImageAreaSigmoid images_production: 343 Sigmoid of maximum image area among actually selected links
MedianImageAreaSigmoid images_production: 344 Sigmoid of meadian image area among actually selected links
MaxPresentImageArea images_production: 476 Max image area sigmoid among links of doc (instead of destinations)
ImageText2TextRelevance images_production: 497 Relevance of the image based on dssm query + top5 links features
ImageText2TextLocalRelevanceV2 images_production: 576 Relevance of the image based on dssm query + features of selected links for request with country name
ImgStaticUtilityMedian images_production: 595 The median value of the static classifier Utiley pictures among Links
ImgStaticUtilityMax images_production: 596 The maximum value of the static classifier of the Utiley pictures among Links
ImgVisualQualityV2Median images_production: 597 Median value of the Visual Quality V2 classifier among Links
ImgVisualQualityV2Max images_production: 598 The maximum value of the Visual Quality V2 classifier is among Links
ImgAesteticsMedian images_production: 599 The median value of the classifier of the aesthetics of pictures among Links
ImgAesteticsMax images_production: 600 The value of the aesthetics classifier of the pictures among links is as much as possible
DssmRandomLogQueryAvgDifferentInternalLinks images_production: 609 The average DifferentinTernallinks for the year for the year.
RandomLogQueryAvgDifferentInternalLinks images_production: 619 The average value is DifferentinTernallinks for the year. It is calculated in offline.
MinLinkAdultnessBetaLevel images_production: 694 Level of minimal AdultnessBeta values among selected links (0.1 = MinAdultnessBetaAboveFamilyThreshold, 0.3 - MinAdultnessBetaAboveGrayThreshold, 0.5 - MinAdultnessBetaAboveNormalThreshold
IsShopInCountry images_production: 713 passage link with IsShop and home src tld exists in doc
IsShopWithMainContentInCountry images_production: 714 passage link with IsShop, MainContent and home src tld exists in doc
PassageCount images_production: 715 Number of passage links in document
RegionPassageCount images_production: 716 Number of regional passage links in document
RegionPassageShare images_production: 717 Share of regional passage links in document
SrcShopShare images_production: 738 Shop share of passage links
SrcLinkCountQ15 images_production: 740 15th percentile of link count on page
SrcShopLinkCountMedian images_production: 742 Median of link count on shop page
SrcShopLinkCountMedianAvgMeta images_production: 799
LinkInstockMax images_production: 819 Maximum battleship on passage lincers
LinkInstockQ90 images_production: 820 90th Perstale Persian probability of Instock on passage links
LinkInstockAve images_production: 821 The average baton of Instock on the passage bursts
LinkInstockMaxRegionMetric images_production: 822 The maximum battleship of Instock on passage linches corresponding to the regional request according to metric
ConveyorRandomLogQueryAvgQfufAllMaxWFLinkAnnIndicatorFullMatchValue images_production: 842 Hippo factor KnnrandomlogqueryFactors-> Conveorrandomlogqueryavgqfuflmaxwflinkannindicatorfullmatchvalue
ConveyorRandomLogQueryAvgDifferentInternalLinks images_production: 843 Hippo factor KNNRANDOMLOGQURYAFACTORS-> ConveyorrandomlogqueryavgdiferentinTernallinks
ImageText2TextRelevanceV3 images_production: 846 Relevance of the image based on dssm t2tv3 query + features of selected links
ImageText2TextBundleRelevanceV3 images_production: 847 Relevance of the image based on dssm query extensions + features of selected links, t2tv3
IsSocialMediaDocument images_production: 856 Does the document have links from social networks
IsSocialMediaDocumentVerifiedOwner images_production: 857 Does the document have Linka from social networks of a verified user
IsSocialMediaDocumentMaxFollowerCount images_production: 858 For the document, the maximum number of followers in Linka from social networks.
IsSocialMediaDocumentMaxRepostCount images_production: 859 For the document, the maximum number of reposts in Linka from social networks.
IsSocialMediaDocumentMaxLikesCount images_production: 860 For the document, the maximum number of likes in Linka from social networks.
MaxActualConversionRegion images_production: 895 The maximum conversion of Owner on passage links that have converts of the host in the query region, AvailaBility = Instock according to Schemorg and the relevant region of the Pagelanguage region
MediaForumLinksShare images_recommendations: 20
ImageTemporalLinksWeight images_recommendations: 41
MediaLinks images_recommendations: 45
ImageLinksFromNews images_recommendations: 46
ImgVisualQualityMedian images_recommendations: 68 The median value of the Visual Quality classifier among Links
ImgVisualQualityMax images_recommendations: 69 The maximum value of the Visual Quality classifier among Links
DocHasWikimedia images_recommendations: 73 TSource or TDestination has link from wikimedia web-sites http://www.wikimedia.org/
MaxImageAreaSigmoid images_recommendations: 119 Sigmoid of maximum image area among actually selected links
MedianImageAreaSigmoid images_recommendations: 120 Sigmoid of meadian image area among actually selected links
ImgStaticUtilityMedian images_recommendations: 186 The median value of the static classifier Utiley pictures among Links
ImgStaticUtilityMax images_recommendations: 187 The maximum value of the static classifier of the Utiley pictures among Links
ImgVisualQualityV2Median images_recommendations: 188 Median value of the Visual Quality V2 classifier among Links
ImgVisualQualityV2Max images_recommendations: 189 The maximum value of the Visual Quality V2 classifier is among Links
ImgAesteticsMedian images_recommendations: 190 The median value of the classifier of the aesthetics of pictures among Links
ImgAesteticsMax images_recommendations: 191 The value of the aesthetics classifier of the pictures among links is as much as possible
MinLinkAdultnessBetaLevel images_recommendations: 215 Level of minimal AdultnessBeta values among selected links (0.1 = MinAdultnessBetaAboveFamilyThreshold, 0.3 - MinAdultnessBetaAboveGrayThreshold, 0.5 - MinAdultnessBetaAboveNormalThreshold
WikiInfobox neural_network_over_dssm_factors: 1 On danny url is a link from inFobox-ov to Wikipedia.
PercentWordsInLinks neural_network_over_dssm_factors: 25 The percentage of the number of words inside the tag <a> .. </a> from the number of all words
PureText neural_network_over_dssm_factors: 58 Long text without links.
IsUnreachable neural_network_over_dssm_factors: 73 The page is unattainable by the links from the muzzle.
HasDownloadLinkOnFile neural_network_over_dssm_factors: 83 The document has a direct link to the file
HasDownloadLinkOnFileHosting neural_network_over_dssm_factors: 84 The document has a link to filehosting
WikiLinkCount neural_network_over_dssm_factors: 87
UBLongPeriodDirectHChildren90CntFromExtHost neural_network_over_dssm_factors: 102 Static URL factor in browser logs for the maximum period. The average number of direct descendants from the host on which they spent more than 90 seconds. The descendant is straight, only if there is a link from our page to the descendant and crossed it.
SeoInPayLinks neural_network_over_dssm_factors: 186 The number of COO-Thrilling links between hosts
RandomLogHostNumLinksFromMPMax neural_network_over_dssm_factors: 272 MAX aggregation of NumLinksFromMP web factor using random log
RandomLogHostWikiLinkCountLogAvg neural_network_over_dssm_factors: 289 LOGAVG aggregation of WikiLinkCount web factor using random log
RandomLogHostDssmRandomLogQueryAvgDifferentInternalLinksLogAvg neural_network_over_dssm_factors: 295 LOGAVG aggregation of DssmRandomLogQueryAvgDifferentInternalLinks web factor using random log
YabarHostInternalTraffic neural_network_over_dssm_factors: 303 The share of suits to the site is not by links (set with hands or from bookmarks)
FI_H_ISLINKPESSIMISED robot_primary: 93
FI_H_COMMLINKSSEOHOSTS robot_primary: 117
FI_L_DIFFERENT_LINK_TEXTS robot_primary: 206
FI_L_NUM_LINKS robot_primary: 207
FI_L_EXTERN_LINKS_PART robot_primary: 208
FI_EL_DIFFERENT_LINK_TEXTS robot_primary: 261
FI_EL_NUM_LINKS robot_primary: 262
FI_INCOMING_LINKS_SIZE robot_primary: 693
FI_L_LINKSDAY robot_primary: 806
FI_L_LINKSDAY_W robot_primary: 807
FI_L_LINKS_FROM_MAIN_PAGE robot_primary: 808
FI_L_LINKS_FROM_MAIN_PAGE_W robot_primary: 809
FI_L_LINKS_RUS robot_primary: 810
FI_L_LINKS_RUS_W robot_primary: 811
FI_L_LINKS_TUR robot_primary: 812
FI_L_LINKS_TUR_W robot_primary: 813
FI_L_LINKS_ENG robot_primary: 814
FI_L_LINKS_ENG_W robot_primary: 815
FI_L_EXTERN_LINKS_SUM_WEIGHT robot_primary: 832
FI_BAD_LINKS_PART robot_primary: 840
FI_VL_DIFFERENT_LINK_TEXTS robot_primary: 886
FI_VL_NUM_LINKS robot_primary: 887
FI_CF_INCOMING_LINK_SAME_ZONE_SUM robot_zonal: 9
FI_CF_INCOMING_LINK_SAME_ZONE_RANK robot_zonal: 10
FI_CF_INCOMING_LINK_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 11
FI_CF_INCOMING_LINK_SAME_ZONE_SHARE_TO_TOP robot_zonal: 12
FI_CF_INCOMING_LINK_TOP_SHARE_TO_TOTAL robot_zonal: 13
FI_CF_HOST_IMAGE_INCOMING_LINK_SAME_ZONE_SUM robot_zonal: 24
FI_CF_HOST_IMAGE_INCOMING_LINK_SAME_ZONE_RANK robot_zonal: 25
FI_CF_HOST_IMAGE_INCOMING_LINK_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 26
FI_CF_HOST_IMAGE_INCOMING_LINK_SAME_ZONE_SHARE_TO_TOP robot_zonal: 27
FI_CF_HOST_IMAGE_INCOMING_LINK_TOP_SHARE_TO_TOTAL robot_zonal: 28
FI_CF_OUTLINKS_SUM_SHOWS_SAME_ZONE_SUM robot_zonal: 32
FI_CF_OUTLINKS_SUM_SHOWS_SAME_ZONE_RANK robot_zonal: 33
FI_CF_OUTLINKS_SUM_SHOWS_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 34
FI_CF_OUTLINKS_SUM_SHOWS_SAME_ZONE_SHARE_TO_TOP robot_zonal: 35
FI_CF_OUTLINKS_SUM_SHOWS_TOP_SHARE_TO_TOTAL robot_zonal: 36
FI_CF_OUTLINKS_SUM_CLICKS_SAME_ZONE_SUM robot_zonal: 37
FI_CF_OUTLINKS_SUM_CLICKS_SAME_ZONE_RANK robot_zonal: 38
FI_CF_OUTLINKS_SUM_CLICKS_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 39
FI_CF_OUTLINKS_SUM_CLICKS_SAME_ZONE_SHARE_TO_TOP robot_zonal: 40
FI_CF_OUTLINKS_SUM_CLICKS_TOP_SHARE_TO_TOTAL robot_zonal: 41
FI_CF_OUTLINKS_SUM_FULL_EXTDATA_SAME_ZONE_SUM robot_zonal: 42
FI_CF_OUTLINKS_SUM_FULL_EXTDATA_SAME_ZONE_RANK robot_zonal: 43
FI_CF_OUTLINKS_SUM_FULL_EXTDATA_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 44
FI_CF_OUTLINKS_SUM_FULL_EXTDATA_SAME_ZONE_SHARE_TO_TOP robot_zonal: 45
FI_CF_OUTLINKS_SUM_FULL_EXTDATA_TOP_SHARE_TO_TOTAL robot_zonal: 46
FI_CF_OUTLINKS_SUM_SHOWS_BY_SR_SAME_ZONE_SUM robot_zonal: 47
FI_CF_OUTLINKS_SUM_SHOWS_BY_SR_SAME_ZONE_RANK robot_zonal: 48
FI_CF_OUTLINKS_SUM_SHOWS_BY_SR_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 49
FI_CF_OUTLINKS_SUM_SHOWS_BY_SR_SAME_ZONE_SHARE_TO_TOP robot_zonal: 50
FI_CF_OUTLINKS_SUM_SHOWS_BY_SR_TOP_SHARE_TO_TOTAL robot_zonal: 51
FI_CF_OUTLINKS_AV_SHOWS_SAME_ZONE_SUM robot_zonal: 52
FI_CF_OUTLINKS_AV_SHOWS_SAME_ZONE_RANK robot_zonal: 53
FI_CF_OUTLINKS_AV_SHOWS_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 54
FI_CF_OUTLINKS_AV_SHOWS_SAME_ZONE_SHARE_TO_TOP robot_zonal: 55
FI_CF_OUTLINKS_AV_SHOWS_TOP_SHARE_TO_TOTAL robot_zonal: 56
FI_CF_OUTLINKS_AV_CLICKS_SAME_ZONE_SUM robot_zonal: 57
FI_CF_OUTLINKS_AV_CLICKS_SAME_ZONE_RANK robot_zonal: 58
FI_CF_OUTLINKS_AV_CLICKS_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 59
FI_CF_OUTLINKS_AV_CLICKS_SAME_ZONE_SHARE_TO_TOP robot_zonal: 60
FI_CF_OUTLINKS_AV_CLICKS_TOP_SHARE_TO_TOTAL robot_zonal: 61
FI_CF_OUTLINKS_AV_FULL_EXTDATA_SAME_ZONE_SUM robot_zonal: 62
FI_CF_OUTLINKS_AV_FULL_EXTDATA_SAME_ZONE_RANK robot_zonal: 63
FI_CF_OUTLINKS_AV_FULL_EXTDATA_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 64
FI_CF_OUTLINKS_AV_FULL_EXTDATA_SAME_ZONE_SHARE_TO_TOP robot_zonal: 65
FI_CF_OUTLINKS_AV_FULL_EXTDATA_TOP_SHARE_TO_TOTAL robot_zonal: 66
FI_CF_OUTLINKS_AV_SHOWS_BY_SR_SAME_ZONE_SUM robot_zonal: 67
FI_CF_OUTLINKS_AV_SHOWS_BY_SR_SAME_ZONE_RANK robot_zonal: 68
FI_CF_OUTLINKS_AV_SHOWS_BY_SR_SAME_ZONE_SHARE_TO_TOTAL robot_zonal: 69
FI_CF_OUTLINKS_AV_SHOWS_BY_SR_SAME_ZONE_SHARE_TO_TOP robot_zonal: 70
FI_CF_OUTLINKS_AV_SHOWS_BY_SR_TOP_SHARE_TO_TOTAL robot_zonal: 71
FI_CF_OUTLINKS_LAST_ADDTIME robot_zonal: 72
FI_CF_OUTLINKS_ADDTIME_DIFF robot_zonal: 73
FI_CF_OUTLINKS_GOOD_SHARE robot_zonal: 74
FI_CF_OUTLINKS_INTERNAL_SHARE robot_zonal: 75
FI_CF_OUTLINKS_PREDICTED_SHARE_TO_GOOD robot_zonal: 76
FI_CF_OUTLINKS_PREDICTED_SHARE_TO_TOTAL robot_zonal: 77
FI_CF_HOST_OUTLINKS_CLICKS robot_zonal: 116
FI_CF_HOST_OUTLINKS_SHOWS robot_zonal: 117
FI_CF_HOST_OUTLINKS_EDR robot_zonal: 118
FI_CF_HOST_OUTLINKS_SHOWS_BY_SR robot_zonal: 119
FI_CF_DIR_OUTLINKS_CLICKS robot_zonal: 120
FI_CF_DIR_OUTLINKS_SHOWS robot_zonal: 121
FI_CF_DIR_OUTLINKS_EDR robot_zonal: 122
FI_CF_DIR_OUTLINKS_SHOWS_BY_SR robot_zonal: 123
FI_CF_PARAM_OUTLINKS_CLICKS robot_zonal: 124
FI_CF_PARAM_OUTLINKS_SHOWS robot_zonal: 125
FI_CF_PARAM_OUTLINKS_EDR robot_zonal: 126
FI_CF_PARAM_OUTLINKS_SHOWS_BY_SR robot_zonal: 127
HostHasLinkedin smelter_worker_processor: 79
links snippets_main: 36
llinks_lp snippets_main: 37
llinks_up snippets_main: 38
llinks_avp snippets_main: 39
link_words_l snippets_main: 43
link_words_u snippets_main: 44
link_words_av snippets_main: 45
seg_local_links_per_link snippets_main: 124
AllMatchedWordWeightsSumLink snippets_webranking_noclick: 29
StringMatchedWordWeightsSumLink snippets_webranking_noclick: 30
AllMatchedWordFiltrationModelWeightsSumLink snippets_webranking_noclick: 34
StringMatchedWordFiltrationModelWeightsSumLink snippets_webranking_noclick: 35
BM25FdPRFixedNoLinks snippets_webranking_noclick: 36
XfDtShowAllMaxWFLinksAllPerWordCMMaxMatchMin snippets_webranking: 14
Langs video_production: 23 The number of different link languages.
BestLR video_production: 36 Link rank the best link.
BestPhraseWeight video_production: 37 The phrasal rank of the best link.
BestTitleLR video_production: 65 Link rank the best heading.
BestDescriptionLR video_production: 67 Link rank the best description.
BestLRSyn video_production: 69 Link rank the best link. Takes into account thesaurus extensions.
BestPhraseWeightSyn video_production: 70 The phrasal rank of the best link. Takes into account thesaurus extensions.
BestTitleLRSyn video_production: 71 Link rank the best heading. Takes into account thesaurus extensions.
BestDescriptionLRSyn video_production: 73 Link rank the best description. Takes into account thesaurus extensions.
Links video_production: 75 The number of braces that were put in the index.
LinksWithHits video_production: 76 The number of links with hits. Takes into account thesaurus extensions.
LinksWithHitsShare video_production: 79 The share of links with hits. Takes into account thesaurus extensions.
BestLinkBocm video_production: 120 The maximum BOCM (compliance of the positions of words in the request and sentences of the document, proximity) in the text of the Links.
HasLinkBase video_production: 134 The lincat database has data on the video embezzles.
BocmFull video_production: 178 Simple BOCM gluing Links.
FirstHitSentenceBocmFull video_production: 179 BOCM for gluing Links, calculated only on the first sentences with hits and all forms of entering are considered equivalent.
BestFirstHitSentenceTocm video_production: 180 The best BOCM among all links, such as Title (analogue of TOCM), calculated as follows: only sentences with hits are considered and all forms of entry are considered equivalent.
DbmVideoNumbers video_production: 183 The new DBM only in terms of gluing links (differs from DBMNUMBERS [157] only constants and completely clogs it).
DbmBestBigNumbers video_production: 185 The best new DBM only by numbers, no less than 12, in links.
MetaLinks video_production: 380 The average value of the LINKS factor is average.
MetaLinksWithHitsShare video_production: 381 The average value of the Linkswithhitsshare factor is average.
MetaBestLinkBocm video_production: 383 The average value of the BestlinkBocm factor is average.
RandomLogQueryAvgDifferentInternalLinks video_production: 632 The average value is DifferentinTernallinks for the year. It is calculated in offline.
DssmRandomLogQueryAvgDifferentInternalLinks video_production: 664 The average DifferentinTernallinks for the year for the year.
DssmRandomLogQueryClicksWeightedAvgDifferentInternalLinks video_production: 678 DiffferentinTernallinks, which is predicted using a neural network, is a weighted net with clicks for a year.
ConveyorRandomLogQueryAvgQfufAllMaxWFLinkAnnIndicatorFullMatchValue video_production: 734 Hippo factor KnnrandomlogqueryFactors-> Conveorrandomlogqueryavgqfuflmaxwflinkannindicatorfullmatchvalue
VideoDWordNavCTRMax video_fresh: 36 Doppel word maximal CTR for video navigational link, calculate on desktop slice
VideoDQueryNavCTR video_fresh: 41 Doppel query CTR for video navigational link, calculate on desktop slice
AddressBigramNavCTRMax video_fresh: 44 Maximal norm bigram maps navigational link CTR, calculate on desktop slice
ImagesBigramUINavCTRMax video_fresh: 59 Maximal norm bigram images navigational link CTR, calculate on current user interface slice
BegemotRandomLogQueryAvgDifferentInternalLinks web_fresh_detector: 129 Factor RandomLogQueryAvgDifferentInternalLinks from begemot
BegemotRandomLogQueryClicksWeightedAvgDifferentInternalLinks web_fresh_detector: 145 Factor RandomLogQueryClicksWeightedAvgDifferentInternalLinks from begemot
BegemotDssmRandomLogQueryAvgDifferentInternalLinks web_fresh_detector: 166 Factor DssmRandomLogQueryAvgDifferentInternalLinks from begemot
BegemotDssmRandomLogQueryClicksWeightedAvgDifferentInternalLinks web_fresh_detector: 182 Factor DssmRandomLogQueryClicksWeightedAvgDifferentInternalLinks from begemot
BegemotKnnRandomLogQueryFactors_RandomLogQueryAvgDifferentInternalLinks web_fresh_detector: 205 Factor KnnRandomLogQueryFactors_RandomLogQueryAvgDifferentInternalLinks from begemot
zen_events_pair_links_domain_visit_30d_count web_itditp_recommender: 27
zen_events_pair_links_domain_visit_3d_count web_itditp_recommender: 28
zen_events_pair_links_domain_feedback_more_3d_rate web_itditp_recommender: 111
zen_events_pair_links_domain_feedback_more_30d_rate web_itditp_recommender: 112
zen_events_pair_links_domain_feedback_less_3d_rate web_itditp_recommender: 113
zen_events_pair_links_domain_feedback_less_30d_rate web_itditp_recommender: 114
zen_events_pair_links_domain_click_30d_rate web_itditp_recommender: 121
zen_events_pair_links_domain_click_similar_30d_rate web_itditp_recommender: 122
zen_events_pair_links_domain_click_3d_rate web_itditp_recommender: 123
zen_events_pair_links_domain_click_similar_3d_rate web_itditp_recommender: 124
zen_events_pair_links_domain_feedback_more_3d_portion web_itditp_recommender: 125
zen_events_pair_links_domain_feedback_more_30d_portion web_itditp_recommender: 126
zen_events_pair_links_domain_feedback_less_3d_portion web_itditp_recommender: 127
zen_events_pair_links_domain_feedback_less_30d_portion web_itditp_recommender: 128
LeftWikiInfobox web_itditp: 2 On danny url is a link from inFobox-ov to Wikipedia.
WikiInfobox web_itditp: 3 On danny url is a link from inFobox-ov to Wikipedia.
LeftPercentWordsInLinks web_itditp: 54 The percentage of the number of words inside the tag <a> .. </a> from the number of all words
PercentWordsInLinks web_itditp: 55 The percentage of the number of words inside the tag <a> .. </a> from the number of all words
LeftIsLinkPessimised web_itditp: 132 Antispamers pessimized the site - all dynamic linseed factors are reset. Zerolnk.flt
IsLinkPessimised web_itditp: 133 Antispamers pessimized the site - all dynamic linseed factors are reset. Zerolnk.flt
LeftCommLinksSEOHosts web_itditp: 138 The share of incoming corrupt links. The algorithm for recognition of commercial links is implemented. The factor will be remarked to [0.1] if the share of such links is 50%, otherwise 0. ((http://wiki.yandex-team.ru/svetlanashorina/topseolinks selection of wound sites))))))
CommLinksSEOHosts web_itditp: 139 The share of incoming corrupt links. The algorithm for recognition of commercial links is implemented. The factor will be remarked to [0.1] if the share of such links is 50%, otherwise 0. ((http://wiki.yandex-team.ru/svetlanashorina/topseolinks selection of wound sites))))))
LeftPureText web_itditp: 282 Long text without links.
LeftIsUnreachable web_itditp: 296 The page is unattainable by the links from the muzzle.
LeftHasDownloadLinkOnFile web_itditp: 333 The document has a direct link to the file
LeftHasDownloadLinkOnFileHosting web_itditp: 334 The document has a link to filehosting
LeftWikiLinkCount web_itditp: 343
LeftUBLongPeriodDirectHChildren90CntFromExtHost web_itditp: 357 Static URL factor in browser logs for the maximum period. The average number of direct descendants from the host on which they spent more than 90 seconds. The descendant is straight, only if there is a link from our page to the descendant and crossed it.
PureText web_itditp: 377 Long text without links.
IsUnreachable web_itditp: 391 The page is unattainable by the links from the muzzle.
HasDownloadLinkOnFile web_itditp: 428 The document has a direct link to the file
HasDownloadLinkOnFileHosting web_itditp: 429 The document has a link to filehosting
WikiLinkCount web_itditp: 438
UBLongPeriodDirectHChildren90CntFromExtHost web_itditp: 452 Static URL factor in browser logs for the maximum period. The average number of direct descendants from the host on which they spent more than 90 seconds. The descendant is straight, only if there is a link from our page to the descendant and crossed it.
LeftYabarHostInternalTraffic web_itditp: 487 The share of suits to the site is not by links (set with hands or from bookmarks)
LeftSeoInPayLinks web_itditp: 500 The number of COO-Thrilling links between hosts
YabarHostInternalTraffic web_itditp: 556 The share of suits to the site is not by links (set with hands or from bookmarks)
SeoInPayLinks web_itditp: 569 The number of COO-Thrilling links between hosts
OriginalRequestLinkAnnFloatMultiplicityAllWcmWeightedPrediction web_l2: 25
OriginalRequestLinkAnnFloatMultiplicityCMMatchTop5AvgMatch web_l2: 26
OriginalRequestLinkAnnFloatMultiplicityCMMatchTop5AvgValue web_l2: 27
OriginalRequestLinkAnnFloatMultiplicityPerWordCMMaxPredictionMin web_l2: 28
OriginalRequestLinkAnnIndicatorAllWcmWeightedPrediction web_l2: 29
OriginalRequestLinkAnnIndicatorAnnotationMaxValueWeighted web_l2: 30
OriginalRequestLinkAnnIndicatorBm15MaxAnnotationK001 web_l2: 31
OriginalRequestLinkAnnIndicatorCosineMatchMaxPrediction web_l2: 32
RequestWithRegionNameLinkAnnFloatMultiplicityAllWcmWeightedPrediction web_l2: 33
RequestWithRegionNameLinkAnnFloatMultiplicityBm15MaxAnnotationK001 web_l2: 34
RequestWithRegionNameLinkAnnFloatMultiplicityBocm15K001 web_l2: 35
RequestWithRegionNameLinkAnnFloatMultiplicityCMMatchTop5AvgPrediction web_l2: 36
RequestWithRegionNameLinkAnnFloatMultiplicityCMMatchTop5AvgValue web_l2: 37
RequestWithRegionNameLinkAnnIndicatorAllWcmWeightedPrediction web_l2: 38
RequestWithRegionNameLinkAnnIndicatorAnnotationMaxValueWeighted web_l2: 39
RequestWithRegionNameLinkAnnIndicatorBm15MaxAnnotationK001 web_l2: 40
RequestWithRegionNameLinkAnnIndicatorCMMatchTop5AvgPrediction web_l2: 41
RequestWithRegionNameLinkAnnIndicatorCosineMatchMaxPrediction web_l2: 42
RequestWithRegionNameLinkAnnIndicatorWordCoverageExact web_l2: 43
MetaPosWikiLinkCount web_meta: 55 FI_WIKI_LINK_COUNT for documents on request at PRS
MetaAvgHasDownloadLinkOnFile web_meta: 109 Avg metafactor on HasDownloadLinkOnFile(avg 682)
MetaRmsDifferentInternalLinks web_meta: 192 Rms metafactor on Production:DifferentInternalLinks(414)
MetaStatMetaMaxLinkAnnLinkExternalBocm11Norm256 web_meta: 280 Max metafactor on Production:LinkAnnLinkExternalBocm11Norm256(1520)
MetaPRSSimDFT_MAXLinkAnnLinkExternalBocm11Norm256 web_meta: 281 DFT_MAX metafactor on Production:LinkAnnLinkExternalBocm11Norm256(1520)
MetaSameWordsMaskAvgTextExactQfufAllMaxFLinkAnnIndicatorAnnotationMaxValueWeighted web_meta: 427 The average value of the QFUFUFALLMAXFLINKANNINNINNONNOTATIONNOTATIONNOWEWEWEWEIGHTED factor in PRS, where a mask of words in the text of a document that coincided exactly the same as that of the document
MetaSameWordsMaskAvgFieldSetUTSynonymQfufAllMaxWFLinkAnnIndicatorFullMatchValue web_meta: 428 The average value of the QFUFUFALLMAXWFLINKANNINNINNINNINNINNDILLMATCHVALUE factor in terms of PRS, where a mask of words in the URL+Title document that coincided or better, the same as the document
RandomLogQueryAvgDifferentInternalLinks web_new_l1: 98 The average value is DifferentinTernallinks for the year. It is calculated in offline.
RandomLogQueryClicksWeightedAvgDifferentInternalLinks web_new_l1: 114 Maintened by clicks DifferentinTernallinks for the year. It is calculated in offline.
DssmRandomLogQueryAvgDifferentInternalLinks web_new_l1: 135 The average DifferentinTernallinks for the year for the year.
DssmRandomLogQueryClicksWeightedAvgDifferentInternalLinks web_new_l1: 149 DiffferentinTernallinks, which is predicted using a neural network, is a weighted net with clicks for a year.
KnnRandomLogQueryAvgDifferentInternalLinks web_new_l1: 172 The average value of Randomlogqueryavgdiferentinternallinks of the nearest KNN queries.
TfICopLink unknown: 0
RankSumICopLink unknown: 1
RankDisSumICopLink unknown: 2
RankDisMaxICopLink unknown: 3
RankMaxICopLink unknown: 4
TfISimLink unknown: 5
RankSumISimLink unknown: 6
RankDisSumISimLink unknown: 7
RankDisMaxISimLink unknown: 8
RankMaxISimLink unknown: 9
RF_Mean_CommLinksSEOHosts unknown: 2 The share of incoming corrupt links. The algorithm for recognition of commercial links is implemented. The factor will be remarked to [0.1] if the share of such links is 50%, otherwise 0. ((http://wiki.yandex-team.ru/svetlanashorina/topseolinks selection of wound sites))))))
RF_Max_NumLinksFromSegmentContent unknown: 16
RF_Mean_SeoInPayLinks unknown: 17 The number of COO-Thrilling links between hosts
RF_Min_Bclmf unknown: 26 BCLM for Annotation index, doc text and links.
RF_MEAN_FI_RandomLogQueryAvgDifferentInternalLinks unknown: 129 Average from RandomlogqueryavgdiferentinTernallinks
RF_MAX_FI_RandomLogQueryClicksWeightedAvgDifferentInternalLinks unknown: 137 maximum of randomlogQueryclickSweigtedavgdifferentinternllinks
RF_LinkQuality unknown: 4 The quality of incoming links (the classifier of the bream) is broken, cm [405]
RF_LinksWithWordsPercent unknown: 8 The percentage of incoming links with the words of the request
RF_LinkAge unknown: 10 The average age of links that brought something to LR linkage = min (log (average age of links)/7, 1), 3 years are adopted for 1
RF_PercentWordsInLinks unknown: 29 The percentage of the number of words inside the tag <a> .. </a> from the number of all words
RF_LinkWeightedForms unknown: 34 Summer of the number of forms balanced by scales
RF_InlinksModel unknown: 51 Probabilistic model built on the texts of incoming links
RF_TitleInLinksTrigrams unknown: 63 The share of unique trigrams in the trigrams of links
llinks_avp unknown: 247
PrBonus unknown: 265 Priority bonus, priority 7 - text priority. The binary factor, matters 0 for all monosyllabic requests, and the value of 1 for almost all two or more words, except for a very small number of answers for which there is not a single link that has passed quorum, and the text also did not pass the quorum.